PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g002970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 300aa    MW: 33962 Da    PI: 4.8765
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g002970.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.6e-1862115356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++  +q+++Le+ Fe ++++  e++++LA++lgL+ rqV vWFqNrRa++k
  Csa12g002970.1  62 KKRRLRVDQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWK 115
                     45578899*********************************************9 PP

2HD-ZIP_I/II128.92.1e-4161153193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrl  +qvk+LE++Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+ktkqlEkdy  Lk++yd+l+++ ++L++++++L +e+++
  Csa12g002970.1  61 EKKRRLRVDQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGILKSQYDSLRHNFDSLRRDNDSLLQEISK 153
                     69*************************************************************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.17E-1853119IPR009057Homeodomain-like
PROSITE profilePS5007116.81157117IPR001356Homeobox domain
SMARTSM003891.5E-1660121IPR001356Homeobox domain
CDDcd000865.96E-1662118No hitNo description
PfamPF000461.4E-1562115IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-1965124IPR009057Homeodomain-like
PRINTSPR000316.9E-68897IPR000047Helix-turn-helix motif
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PRINTSPR000316.9E-697113IPR000047Helix-turn-helix motif
PfamPF021832.3E-16117156IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MKRLSSSDSM CGLISTSTDE QSPRGYGSNY QSMLEGYDED ATLIEEYSGN NHNHHHMGLS  60
EKKRRLRVDQ VKALEKNFEL ENKLEPERKT KLAQELGLQP RQVAVWFQNR RARWKTKQLE  120
KDYGILKSQY DSLRHNFDSL RRDNDSLLQE ISKIKATING EEEDNNKATT ESVKREEVVS  180
LPDSSTPSSP LQFLDHSTGF NYRRSFTDLR DLLPNSTGVF DAGSSDSCDS SAVLNEETSS  240
DNGRTTPPST VAGGSFLQFV KTEQREDHDD FLSGEEACGF FSDEQPPSLH WYSASDHWT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109117RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010446568.10.0PREDICTED: homeobox-leucine zipper protein ATHB-16-like
SwissprotQ940J10.0ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16
TrEMBLR0F6G20.0R0F6G2_9BRAS; Uncharacterized protein
STRINGAT4G40060.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-171homeobox protein 16